English class VIII

80+ Right Form of Verb Exercise For JSC Questions with Solutions

Right Form of Verb Exercise For JSC Questions

1.     Complete the following text with suitable verbs in the box with their right form.

takebesurprisewishknowsee gobecome

        Paul (a) ¾ when he met sue at the party. He thought that she (b) ¾ away from their locality. The last time he saw her while she (c) ¾ her driving test. Paul came to (d) ¾ that she (e) ¾ sick for the last two months. She (f) ¾ very thin. Anyway, (g) ¾ her back again, Paul was happy and (h) ¾ her good health. (Adapted from Heaton JB (1988) Writing English Language Test Longman Group UK Ltd. London and New York)

2.     Complete the following text with suitable verbs in the box with their right form :

obtainleadtakeredefinegetenlightengoregard

        Education is (a) ___ as the yardstick of development. Development and education (b) ___ hand in hand. (c) ___ degrees is not the prime objective of education. But our young generation (d) ___ educated to have a job with certain degrees. Now education has to be (e) ___. In fact, education is meant for (f) ___ an individual and creating a sense of morality. Education without morality cannot (g) ___ a nation to success. It is high time, we (h) ___ measures to spread true education.

3.     Complete the following text with suitable verbs in the box with their right form :

followbesucceedstopmakewaithaveneglect

        Time (a) ___ very valuable. This valuable time (b) ___ for nobody. No power can (c) ___ it. It knows no pause in its course. It is not wise to (d) ___ time. The man who (e) ___ the best use of time is sure to (f) ___. All the famous persons of the world (g) ___ made the best use of time. They should be (h) ___ by us.

4.     Complete the following text with suitable verbs in the box with their right form :

leadworkmakebuildbeprosperrememberdepend

        Bangladesh (a) ___ full of natural resources. The prosperity of the country (b) ___ on the proper utilization of the resources. So, we should all try to (c) ___ up our country by (d) ___ hard. We should not (e) ___ a lazy life. No nation (f) ___ without industry. It (g) ___ that industry is the key to success. If we (h) ___ the best use of our resources, Bangladesh will (h) ___ become prosperous.

5.     Complete the following text with suitable verbs in the box with their right form :

comeclimbthinkwalkknowliebego

        Once there were two friends. One day they were (a) ___ through a forest. Suddenly a bear (b) ___ out of the forest. One of the friends (c) ___ up a tree. The other friend did not (d) ___ how to climb up a tree. He (e) ___ down on the ground as if he (f) ___ dead. The bear came and put his nose on the face of the man. He (g) ___ him to be dead and (h) ___ away.

6.     Complete the following text with suitable verbs in the box with their right form :

dependtakeberegainwaitrecovermakego

        A proverb (a) ___ that time and tide (b) ___ for none. Since the dawn of civilization time is moving. It goes on and on. It (c) ___ any rest. Lost health may be (d) ___ by medicine and proper caring and nursing. Lost wealth by dint of hard labour but lost time cannot be (e) ___ by any means. Success in life (f) ___ an a proper division of our time and do our duties accordingly, we (h) ___ sure to reach the cherished goal of our life.

7.     Complete the following text with suitable verbs in the box with their right form :

sleepseeaskreplywritelovedowake

        Once Abu was (a) ___ in his room. Suddenly he (b) ___ up hearing a sound. He (c) ___ that an angel (d) ___ something. He (e) ___ the angel what he (f) ___. The angel (g) ___ that he was writing the names of those who (h) ___ humanity. Abu requested him to write down his name.

8.     Complete the following text with suitable verbs in the box with their right form :

repentpreparewaitmakefollowwastebearcall

        Student life is the best time for (a) ___ oneself for future. It is (b) ___ the seedtime of life. So during this period of life students mustin’t (c) ___ time. They should (d) ___ in mind that time (e) ___ for none. If a student neglects his time, he will have to (f) ___ in future. All the famous persons of the world have to (g) ___ the best use of time. We should (h) ___ their footprints to succeed in life.

9.     Complete the following text with suitable verbs in the box with their right form :

movesucceedperformfollowwaitneglectmakebe

        Time (a) ___ very precious. Time (b) ___ for none. No power can stop it. It (c) ___ forward and forward. It is not wise to (d) ___ time. Those who make the best use of time are sure to (e) ___. All the great persons of the world have (f) ___ the best use of time. We must (g) ___ them. If we can realize it and (h) ___ our deeds in time, we can go far.

10.  Complete the following text with suitable verbs in the box with their right form. (Rajuk Uttara Model College, Dhaka)

begetgivestandproduceendure

        Trees (a) ——- shade for the benefit of other people and while they (b) ——- in the sun and (c) ——- scorching heat. They (d) ——- fruits by which others (e) ——- profit. The character of good men (f) ——- like that of trees. What is the use of that perishable body if it (g) ——- of no use? It (h) ——- made for the benefit of mankind.

11.  Complete the following text with suitable verbs in the box with their right form. (P. N. Govt. Girls’ High School, Rajshahi)

inventaddprosperdependtoilbelivehavethinkhelp

        Man (a) ——- the maker of his own fortune. If we (b) ——- fear of work, we cannot (c) ——- in life. Some people (d) ——- that success in life (e) ——- on luck or chance. Scientists have (f) ——- day and night in their laboratories with a view to (g) ——- radio, television and computer. These instruments (h) ——- to the joy of our life.

12.   Complete the following text with suitable verbs in the box with their right form. (Dinajpur Zilla School, Dinajpur)

sufferrepletehavecallperformcrownbecomebe

        Awareness about doing duty is (a) ——- dutifulness. Human life is (b) ——-with duties and responsibilities. There (c) ——- no adult person who does not (d) ——- any duty. Human beings’ birth on this earth is for (e) ——- certain duties. He who does not do his duty and responsibility (f) ——- in the long run. By performing the duties properly, a man can be (g) ——- with success. He (h) ——- prosperous and happy in life.

13.   Complete the following text with suitable verbs in the box with their right form. (Jessore Zilla School, Jessore)

beseegivegogetbeatreachenter

        My JSC Exam (a) ——- on. On the exam date of English 2nd Paper I (b) ——- stuck up in traffic jam. So I (c) ——- the exam hall half an hour late. After (d) ——- the exam hall, I (e) ——- that all the examinees (f) ——- busy in writing. The invigilator (g) ——- me the answer script and the question paper. I got nervous. My heart (h) ——- fast.

14.   Complete the following text with suitable verbs in the box with their right form. (Comilla Zilla School, Comilla)

besendfindsuffertakerushhearmisbehave

        One of my friends (a) ——- from typhoid for a long time. Suddenly his condition deteriorated. So he (b) ——- to a nearby clinic. (c) ——- this news, I (d) ——- to the clinic to see him. I (e) ——- him seriously ill. To my utter surprise, I saw that the doctors (f) ——- not cordial at all. They (g) ——- any care of him. Even they (h) ——- towards his parents.

15.  Complete the following text with suitable verbs in the box with their right form. (Chittagong Collegiate School, Chittagong)

continuepreachreigntroubleunderstandtriumphstoprespect

        Truth always (a) ——- in the world. Falsehood may (b) ——- for the time being. Those who are engaged in (c) ——- the truth are (d) ——- by the people. Those who feel interested in telling lies cannot prosper in life. They may prosper seemingly, but they can (e) ——- all the time. Socrates throughout his life would preach the truth. He tried to make people (f) ——- what was good for them. He was (g) ——- by the powerful people. In spite of it, he never (h) ——- teaching good things.

16.  Complete the following text with suitable verbs in the box with their right form. (Jalalabad Cantt. Public School & College, Sylhet)

learntakebespeaklearnlikeenrichbe

        English (a) ——- an international language. There (b) ——- no country in the world where English is not (c) ——-. Once one has (d) ——- delight in this language, one cannot but (e) ——- it. It is with the purpose to (f) ——- the Bangla language that English should be (g) ——-. Do you not (h) ——- speaking English?

17.  Complete the following text with suitable verbs in the box with their right form. (Barisal Govt. Girls’ High School, Barisal)

bekeepneedlearngorevisedesigndevelop

        Communicative competence in English is urgently (a) ——- in our country. The present world (b) ——- fast, and (c) ——- by leaps and bounds. In order to (d) ——- pace with the present world, we cannot help (e) ——- English but the present system of teaching and learning English (f) ——- not up to the mark. The textbooks (g) ——- for the secondary level have to (h) ——- and made updated.

18.  Complete the following text with suitable verbs in the box with their right form. (Viqarunnisa Noon School & College, Dhaka)         

beginattaincostformlearnremainrespectshow

        Good manners (a) ——- an important part of our education. Our education (b) ——- incomplete if we do not (c) ——- good manners. In our behaviour with others if we do not (d) ——- respect to them, they will not (e) ——- us. Good manners (f) ——- us nothing. Our children should (g) ——- good manners from the very (h) ——- of their life.

19.  Complete the following text with suitable verbs in the box with their right form. (Ideal School & College, Motijheel, Dhaka)       

seedestroylosecausescuttinghasposeplantincreasebe

        Global warming is (a) ——- day by day. It is mainly (b) ——- by the destruction of forests. Everyday we (c) ——- down trees recklessly but do not (d) ——- a single tree. As a result, wild animals are (e) ——- their living places. Many birds and animals are (f) ——- no more. This loss (g) ——- a threat to our environment by (h) ——- the ecological balance.

20.  Complete the following text with suitable verbs in the box with their right form. (Dhaka Residential Model College, Dhaka)       

determineadoptleadrisespeakachievetrybe

        Honesty is a great virtue. An honest man is liked and trusted by all. The ignorant men adopt unfairness with a view to (a) ——- their objectives. In every walk of life, honesty (b) ——- a must. An honest man may be poor, but he (c) ——- to become rich by (d) ——- dishonest means. His progress in life may be slow, but he (e) ——- very high in the long run. The habit of (f) ——- the truth is honesty. To talk about a thing exactly is truth. Everyone (g) ——- to speak the truth and (h) ——- the life in an honest way.

21.   Complete the following text with suitable verbs in the box with their right form. (Bogra Zilla School, Bogra)            

hasbeearnregardlagfollowfailavoid

        Language (a) ——- as the best medium to express our feeling. A language (b) ——- in two ways through learning and acquisition. When a man learns his mother tongue he (c) ——- nothing but spontaneity. On the contrary, to learn a foreign or second language one (d) ——- conscious. Without (e) ——- a conscious learner none can (f) ——- the art of speaking like a foreigner. If anyone (g) ——- in this regard he (h) ——- behind.

22.   Complete the following text with suitable verbs in the box with their right form. (Rangpur Zilla School, Rangpur)    

refreshappealcharmcanfillgospendbe

        I have a temporary residence in the town. But I have to (a) ——- to the village from time to time. Village life (b) ——- to me very much. I (c) ——- my childhood there. The memories of past days (d) ——- very sweet. Oh! Would that I (e) ——- live in the countryside forever. The present life is not so astonishing, thrilling, pleasing and charming as childhood days (f) ——-. Now I (g) ——- a young man but still the sweet memories of those days (h) ——- my heart and mind with an immense joy.

23.  Complete the following text with suitable verbs in the box with their right form. (Udayan Higher Secondary School, Dhaka)       

runbespendgetearnbringmakesatisfy

        Money (a) ——- one happy unless it (b) ——- through fair means. There are people who have a lot of money but it (c) ——- peace of mind to them. Their hours and days (d) ——- only for earning money. Thus, they get used to (e) ——- after it till death. But we should bear in mind that happiness (f) ——- a psychological thing. Everybody cannot (g) ——- it. He who (h) ——- with what he gets is really a happy man.

24.  Complete the following text with suitable verbs in the box with their right form. (Monipur Uchcha Vidyalaya & College, Mirpur, Dhaka)         

seelookcryreachruntakeaccompanywound

        That day I was on my way to school, (a) ——- by a number of class fellows. Suddenly a terrible sound (b) ——- our ears and we (c) ——- back. We (d) ——- that a boy (e) ——- over by a car and people were (f) ——- all around. The boy had a torn shirt and was seriously (g) ——-. We (h) ——- the wounded boy to the hospital.

25.  Complete the following text with suitable verbs in the box with their right form. (Adamjee Cantonment Public School, Dhaka)         

buildturnfaceexporttrysolvesendcontribute

        Nowadays Bangladesh (a) ——- unemployment problem. This problem already (b) ——- an alarming dimension. The government (c) ——- to cope with this problem but this problem can (d) ——- if our vast population (e) ——- into human resource. Bangladesh (f) ——- skilled human resource to the developed countries. They (g) ——- to the GDP of the country by (h) ——- their earnings to the country as remittance.

26.  Complete the passage with suitable verbs from the box. Use them in their right form. (The Millennium Stars School & College, Rangpur Cantonment, Rangpur)

costshowhaveformremainacquirewinpractise

        Good manners (a) ——- an important part of our education. Our education (b) ——- incomplete if we do not learn good manners. In our behaviors with others we should (c) ——- proper respect to them. We should (d) ——- a sense of propriety in our conduct with others. Good manners (e) ——- us nothing but earn everything. Childhood is the best time to (f) ——- good manners. They (g) ——- love and respect of others. So, we should (h) ——- good manners in our daily life.

27.  Complete the passage with suitable verbs from the box. Use them in their right form. (Rangpur Govt. Girls’ High School, Rangpur)

holdbemakespeaksitplaydispelbuild

        A teacher (a) ——- an architect of a nation. He (b) ——- an important role in nation. While (c) ——- up an educated nation. He (d) ——- the darkness of ignorance from the lot of a nation. While (e) ——- in the class he has to suit his act according to the need of the students. He is able to (f) ——- the attention of the students. He (g) ——- motionless before his class. He usually (h) ——- his lessons interesting. 

28.  Complete the passage with suitable verbs from the box. Use them in their right form. (Cantonment Public School & College, Saidpur, Nilphamari)

sinkenterflystandgobechangework

        Time (a) ——- away very soon. It (b) ——- on and on. It does not (c) ——- still. In the same way the 20th century (d) ——- into oblivion of time. We (e) ——- into the 21st century. But to make this centre memorable, we (f) ——- to work a lot. Because only hard work (g) ——- the condition of a nation. Let us start (h) ——- right now.

29.  Complete the passage with suitable verbs from the box. Use them in their right form. (Lions School & College, Saidpur, Nilphamari)

makefollowwasteneglectsucceedwaitlook

        Time is very valuable. Time doesn’t (a) ——- for anybody. No power can stop it. It moves forward and forward. It is not wise to (b) ——- time. Those who make the best use of time are sure to (c) ——-. All the great men of the world have (d) ——- the best use of time. We should (e) ——- them. Similarly, if a student (f) ——- his studies from day-to-day, no amount of hand labour before the examination will get him through. If we (g) ——- around, we shall see that the successful men in all spheres of life are men who (h) ——- proper use of every moment of their time.

30.  Complete the passage with suitable verbs from the box. Use them in their right form. (Thakurgaon Govt. Boys’ High School, Thakurgaon.)

relybebuildbecontributeworkleadbring

        Bangladesh (a) ——- full of natural wealth. The well-being of the country (b) ——- on the right utilization of the wealth. We should not (c) ——- a lazy life. We should all (d) ——- up our country. In this respect, every citizen has to (e) ——- hard. No nation of the world can prosper without industry. It should be remembered that industry (f) ——- prosperity. For the development of Bangladesh each and every citizen should (g) ——- in their respective job. If all citizens (h) ——- aware of it, it will be possible to have a good country to live.

31.  Complete the passage with suitable verbs from the box. Use them in their right form. (Thakurgaon Govt. Girls’ High School, Thakurgoan.)

provideturntryfaceneedtakesolvegive

        Nowadays Bangladesh (a) ——- unemployment problem. This problem already (b) ——- an alarming dimension. The government (c) ——- to cope with this problem. But this problem can (d) ——- if our vast population (e) ——- into human resource. Steps for (f) ——- the unemployed and the jobless with jobs should be taken at an early date. Emphasis (g) ——- on agriculture, agro-based industries and cottage industries. Vocational education (h) ——- to be introduced to make them skilled with practical working experience.

32.  Complete the passage with suitable verbs from the box. Use them in their right form. (Gaibandha Govt. Girls’ High School, Gaibandha; Bogra Govt. Girls High School, Bogra; Govt. KD High School, Naogan)

obtaingohelpdenyregardtakeredefinedepend

        Education is (a) ——- as the yardstick of development. Development and education (b) ——- hand in hand. (c) ——- degree is not the prime objective of education. Education has to be (d) ——-. It is high time we (e) ——- measures to spread education. Only the educated persons (f) ——- their children in education. Therefore, none (g) ——- the fact that the foundation of any country is largely (h) ——- upon the education of its youth.

33.  Complete the following text with suitable verbs in the box with their right form. (Gaibandha Govt. Boys’ HIgh School, Gaibandha)

inspiretakecontrolparalyseearntrygroanreplace

        Price of essentials is such a crucial factor that it directly (a) ——- the life and living of the majority of people. The measures so far (b) ——- by the government (c) ——- appreciation from the people. But it is being (d) ——- by despair as majority of people have been (e) ——- under the crushing burden of galloping prices.

34.  Complete the passage with suitable verbs from the box. Use them in their right form. (Govt. Girls’ High School, Jessore)

shineundergobesayshoulderestablishbewant

        It goes without (a) ——- that most of the parents (b) ——- to see their children (c) ——- in life. For this, they are always ready (d) ——- any risk. But the tragedy (e) ——- that our boys and girls want (f) ——- in a short cut way. They think that it (g) ——- better if they could have established themselves without (h) ——- hard work.

35.  Complete the passage with suitable verbs from the box. Use them in their right form. (Dawood Public School, Jessore Cantt., Jessore)

establishbeginbebreakawakenedmakehelp

        Nazrul’s writings (a) ——- full of hope, energy, aspiration and result. his writings (b) ——- the sleeping people of this subcontinent. It (c) ——- Nazrul through whom the people (d) ——- do hope for better future. He (e) ——- them conscious of their rights. He (f) ——- them to fight for independence and (g) ——- the bondage of slavery and fetters of subjugation. He (h) ——- himself in our heart. 

36.  Complete the following text with suitable verbs in the box with their right form. (Vidyamoyee Govt. Girls; High School, Mymensingh)

golearnlivetakegetexercisemouldshape

        A mother (a) ——- an undeniable influence in (b) ——- of children’s character and in (c) ——- their future destiny. The things that they (d) ——- at home (e) ——- at home (e) ——- a firm root in them. And it (f) ——- without saying that this learning they (g) ——- mostly from their mother as they (h) ——- under her direct supervision and constant care.

37.  Complete the following text with suitable verbs in the box with their right form. (Mymensingh Zilla School, Mymensingh; Momena Ali Biggan School, Sirajganj; Milestone College, Dhaka.)

sendbringconquerbethinklinkmadelive

        We (a) ——- in an age of science. We can see the wonders of science around us. Science (b) ——- our life easy and comfortable. We (c) ——- our modern life without science. Science (d) ——- up the distant parts of the world. Telephone, telex, fax, wireless (e) ——- great wonders. They (f) ——- the world closer to us. We can (g) ——- news from one corner of the world to other within a moment. They (h) ——- space.

38.  Complete the following text with suitable verbs in the box with their right form. (Rajshahi Govt. Girls’ High School, Rajshahi)

destroybeachievegocomparedestroydisturbforbid

        Often anger (a) ——- to fire because it spoils one’s all good qualities as fire burns and (b) ——- our valuable things. Of course, a man may get angry but if his anger (c) ——- beyond control, it becomes destructive. At the time of anger man’s peace of mind (d) ——- as conscience cannot work. In all religions anger (e) ——-. Our many good deeds which (f) ——- by hard work and determination may (g) ——- within a moment for anger. (h) ——- angry we commit ruinous and dangerous deeds.

39.  Complete the following text with suitable verbs in the box with their right form. (Rajshahi Collegiate School, Rajshahi)

useintroduceinventworkcometakebebring

        Computer has (a) ——- about a revolutionary change in the world. But it (b) ——- overnight. It (c) ——- a long time to invent computer. Many votaries of science (d) ——- hard for years and finally (e) ——- out successful. Many government and non-government offices, educational institutions (f) ——- computers. A course on computer (g) ——- in secondary and higher levels. The day is not far to come when it (h) ——- used in every sphere of life.

40.  Complete the following text with suitable verbs in the box with their right form. (Govt. Laboratory High School, Rajshahi)

collectbeerasedigitalizesavegaindenysubmit

        Recently the word ‘Digital Bangladesh’ has (a) ——- a great popularity in Bangladesh. Now the government (b) ——- every ministry. Through internet people (c) ——- every piece of information. Moreover, admission form is collected and (d) ——- through internet in every university. So, it (e) ——- the wastage of time. It rather (f) ——- our time and money. So, it cannot be (g) ——- that Digital Bangladesh (h) ——- urgently necessary for the better generation.

41.  Complete the following text with suitable verbs in the box with their right form. (Bogra Cantonment Public School & College, Bogra; Gazipur Cantonment Board Inter High School, Gazipur)

bebeatreachgogivegetentersee

        My JSC exam (a) ——- on. On the exam date of English 1st paper I (b) ——- sutck up in traffic jam. So I (c) ——- the exam hall half an hour late. After (d) ——- the exam hall, I (e) ——- that all the examinees (f) ——- busy in writing. The invigilator (g) ——- me the answer script and the question paper. I got nervous. My heart (h) ——- fast.

42.  Complete the following text with suitable verbs in the box with their right form. You can use negative if necessary. (BIAM Model School & College, Bogra)

describeimaginebringusegoturndependthink

        A proverb (a) ——- that water is life. Actually the importance of water cannot be (b) ——- in words. The existence of any living thing (c) ——- without water. We cannot do a single day without it. It (d) ——- for various purposes. Our agriculture which (e) ——- to be blood of our economy fully (f) ——- on water. Sometimes water (g) ——- untold sufferings for our farmers. If the rainfall is timely and moderate, they (h) ——- out bumper crops.

43.  Complete the following text with suitable verbs in the box with their right form. (Pabna Govt. Girls’ High School, Pabna)

situatedcomefallrecognizetakelivebejumpsee

        One day a farmer (a) ——- some sacks of wheat to a mill (b) ——- a few kilometers away. On the way the horse stumbled and one of the sacks (c) ——- to the ground. It was too heavy for the farmer to lift and there was nobody around to help him. He was at a loss. Meanwhile, he (d) ——- a horseman coming towards him. His heart (e) ——- as the rider (f) ——- nearer. The farmer (g) ——- him. It was no other than the nobleman who (h) ——- in a great house at the top of the hill.

44.   Complete the following text with suitable verbs in the box with their right form. (Pabna Zilla School, Pabna)

breedtrustachievecultivatemaketell

        Truthfulness (a) ——- all other virtues which (b) ——- a man really great. The man who (c) ——- the habit of speaking the truth is (d) ——- by others. A man (e) ——- his ends once or twice by (f) ——- lies.

45.  Complete the following text with suitable verbs in the box with their right form.

        (Dinajpur Govt. Girls’ High School, Dinajpur)

dividetakepickgivefellgetclimbtake

        One day Meena and her parrot, Mithu, (a) ——- a tall tree to pick a mango. She picked the mango and (b) ——- it to her mother. Although Meena had (c) ——- the mango, her mother (d) ——- the whole mango to Raju. Meena (e) ——- very disappointed. Mithu also (f) ——- frustrated. It (g) ——- the mango and (h) ——- it into two equal halves.

47.  Complete the following text with suitable verbs in the box with their right form. (Cantonment Board High School, Dinajpur)

dependtakegoberegainwaitrecovermake

        A proverb (a) ——- that time and tide (b) ——- for none. Since the dawn of civilization time is moving. It goes on and on. It (c) ——- not any rest. Lost health may be (d) ——- by medicine and proper caring and nursing, lost wealth by dint of hard labour but lost time cannot be (e) ——- by any means. Success in life (f) ——- on the best use of time. If we (g) ——- a proper division of our time and do our duties accrdingly, we (h) ——- sure that we would be able to march in life and reach the cherished goal of our life.

48.  Use right form of verbs in the following gaps. (Cantonment Public School & College, Rangpur)

saverequirebecomeeducateconsiderachievekeeprise

        Education is often compared to light and (a) ——- as the pillar of human civilization. So, it is only education which can make a nation (b) ——- to the level of standard development. From this point of view, it (c) ——- quite clear to us that if a country can provide its people with education (d) ——- for the modern aspect of life, it will be able to (e) ——- an all-out prosperity to the betterment of the nation. So, it can easily (f) ——- us from miseries. (g) ——- this in mind, we should try to (h) ——- next generation at any cost.

49.  Complete the passage with suitable verbs from the list. Put them in correct tenses. Use negatives where necessary. (Mirzapur Cadet College, Tangail)

helpspendhavetakeprovidepassbe

        Adult allowance is a noble program taken in our country. In most of the developed countries of the world, this kind of program (a) ——- by the government. The adults (b) ——- by the government. But in our country the adults are mostly dependent on their sons and daughters. They (c) ——- the ability to work and earn. They (d) ——- sometimes treated roughly by their issues.

50.  Complete the following text with suitable verbs in the box with their right form. (Mymensingh Girls’ Cadet College, Mymensingh)

aimunemploythinkdoenlightenbasedevelopbroaden

        The purpose of education is to (a) ——- the spirit. But many (b) ——- that the purpose of education is to teach people how to earn their livelihood. (c) ——- on such wrong idea about the purpose of education, some think that if they cannot educate their children, their children will be (d) ——-. In fact, what education (e) ——- is broadening outlook of the learner. University is a topmost level of institution in the realm of education. This education (f) ——- at the all-round development of the students by imparting knowledge, information and (g) ——- character and personality of the learners. The education of this level is comprehensive that (h) ——- the outlook.

51.   Complete the following text with suitable verbs in the box with their right form. (Rajshahi Cadet College, Rajshahi)

canenablesleepbeworkbecomegethave

        Wealth (a) ——- no doubt necessary for happiness in life. But it (b) ——- a tendency to concentrate in the hands of a few. The result is the rich (c) ——- richer and the poor, poorer. This is certainly a misuse of wealth. It (d) ——- fairly distributed among all so that it (e) ——- bring happiness to the greatest number of people in society. And again we should remember that health is the greatest wealth of man on earth. It (f) ——- us to enjoy worthy happiness. This is why, it is more valuable than the king’s crown and soft bed. A healthy man (g) ——- soundly at night and (h) ——- hard to achieve his end.

52.  Complete the following text with suitable verbs in the box with their right form. (Pabna Cadet College, Pabna; Kushtia Govt. Girls’ High School, Kustia.)

givemakeenableliegetthinkimprovemean

        Physical exercise (a) ——- the regular movement of the limbs of our body according to rules. There (b) ——- a close connection between body and mind. We (c) ——- of a sound mind without a sound health. It is physical exercise which (d) ——- us to build a good health. Physical exercise (e) ——- our body active and the muscles strong. It also (f) ——- our power of digestion and blood circulation. It (g) ——- strength to our brain. A machine (h) ——- rusty for want of proper use. Human body is also a machine.

53.  Complete the following text with suitable verbs in the box with their right form. There are more words than necessary. (Joypurhat Girls’ Cadet College, Joypurhat)

irrigatecanneedpreventbeforminventcause

        Crops (a) ——- water. So farmers must (b) ——- their fields if their is very little rain at any time. Irrigation is not easy if there (c) ——- no river close to the crops. Canals (d) ——- carry water to the field. Sometimes much water (e) ——- flood. A dam may (f) ——- difficulties of irrigation. A great lake can be (g) ——- behind the dam. Dams have not been recently (h) ——-.

54.  Complete the following text with suitable verbs in the box with their right form. (Rangpur Cadet College, Rangpur)

burnliverushgocrywakesleeprun

        Last Sunday I (a) ——- to bed at 9 pm and (b) ——- a sound sleep. Suddenly I (c) ——- up when I heard a hue and cry at a distance. I got up from bed and (d) ——- to he spot. I saw that a cottage (e) ——-. People (f) ——- towards it. The old woman and the poor little girl who (g) ——- in it could not come out. They (h) ——- for help inside the cottage.

55.   Complete the following text with suitable verbs in the box with their right form. (Jhenidah Cadet College, Jhenidah)

rememberconstructcoverincludelaysymbolizeproveinaugurate

        The National Memorial (a) ——- the nation’s respect for the martyrs. It was (b) ——- on the first anniversary of the Victory Day to (c) ——- the sacrifice of the martyrs. Our love for the country is (d) ——- after (e) ——- the National Memorial. The foundation (f) ——- on the first anniversary of the Victory Day. The entire complex (g) ——- an area of 126 acres. The plan of this complex (h) ——- a mosque, a library and a museum.

56.   Complete the following text with suitable verbs in the box with their right form. (Comilla Cadet College, Comilla)

helpneedinventescapetryto bedieto have

        Man (a) ——- no escape from death. Sooner or later he is to (b) ——-. He dies in many ways. Medicines have been (c) ——- to preserve dead bodies. But it will (d) ——- an unsuccessful attempt if man tries to (e) ——- death. In our short life, we must (f) ——- to do something for our country. Our country (g) ——- mass education. About 68% people in our country are illiterate. Education only (h) ——- them in this respect.

57.  Complete the following text with suitable verbs in the box with their right form. (Faujdarhat Cadet College, Chittagong)

makedividelastholdisstartadoptconsist

        In recent years all British universities have (a) ——- the semester system. A semester (b) ——- a period of time which (c) ——- for half of the academic year. Semester 1, for example (d) ——- in September and finishes in January. Previously, the academic year (e) ——-, into three terms; autumn, winter and spring. Most courses (f) ——- of modules which last for one semester, and exams (g) ——- at the end of each. Britain began holding semesters to (h) ——- it easier for international students to move from one country to another.

58.  Use the right form of the following verbs to complete the passage below. (Sylhet Cadet College, Sylhet)

spendbegofillappealrefreshcancharm

        I live in a city. However, I have to (a) ——- to the village from time to time. Village life (b) ——- to me very much. I (c) ——- my childhood there. The memories of past days (d) ——- sweet. I wish I (e) ——- live in the countryside forever! My present life in city is not as charming as childhood days in village (f) ——-. Those sweet days (g) ——- me still and (h) ——- my mind.

59.   Complete the following text with suitable verbs in the box with their right form. (Barisal Cadet College, Barisal)

shallmaintainbeprepareshallformfollowinfluence

        Student life is the golden season of life. This is the time when we should (a) ——- ourselves for future. The very habits (b) ——- in the student life (c) ——- the later phases of life. Right from the student life, they (d) ——- be careful in (e) ——- discipline. He (i) ——- in the hand of the country’s political leaders. He (g) ——- used by any of them in any case or at any time. He (h) ——- respect his teachers or superiors.

60.  Complete the following text with suitable verbs in the box with their right form. (Shamsul Haque Khan School & College, Dhaka)

wakehaveloveobeyfeellivetellsleep

        Long ago, there (a) ——- a widow in a certain village of Bustam. She (b) ——- a son of nine years old. She (c) ——- him dearly. The boy also loved and (d) ——- her very much. One night when the entire village was in deep sleep, the boy was awake and busy in studies. His beloved mother (e) ——- too. All on a sudden, she (f) ——- up and (g) ——- very thirsty. She (h) ——- her son with dozing eyes to give her a glass of water and fell asleep again.

61.  Complete the following text with suitable verbs in the box with their right forms. (Motijheel Govt. Boys’ High School, Dhaka)

losehaveovercomediesucceedbeestablishascend

        After Humayun (a) ­­——-, he (b) ­­——- by his eldest son, Akbar. He (c) ——- then only 14 years old and he (d) ——- a very difficult situation to face. But he (e) ——- the problems one after another with the help and advice of Bairam Khan, his guardian. Soon after (f) ——- to the throne, Akbar had to firmly (g) ——- Mughal authority and regain the territories it (h) ——-.

62.  Complete the passage with suitable verbs from the list. Put them in correct tenses. Use negatives where necessary. (Bir Shreshtha Noor Mohammad Public College, Dhaka)

keepdevelopneedlearngodomodifyrevisedesign

        Communicative competence in English is urgently (a) ——-. The present world is (b) ——- fast and (c) ——- by leaps and bounds. In order to (d) ——- pace with the present world, we cannot help (e) ——- English. But the present system of teaching and (f) ——- English is not satisfactory. The textbooks (g) ——- for classes IX-X have to (h) ——- and make updated.

63.  Complete the following text with suitable verbs in the box with their right form. (Motijheel Model High School & College, Dhaka)

goquarrelrespectlovelearnbekeeplisten

        There (a) ——- a boy named Karim. He was twelve years old. Everyday he (b) ——- to school in time. He always (c) ——- his lessons attentively. He (d) ——- with anyone. He did not (e) ——- company with bad boys. He (f) ——- his teacher very much. He (g) ——- attentively to what the teachers said. So everybody (h) ——- him.

64.  Complete the following text with suitable words form the box. (Govt. Laboratory High School, Dhaka)

managecommitmeanslosedamagecursetakeleadseriousattractionfeelultimate

        Strong (a) ——- for any harmful thing (b) ——- addiction. Drug is (c) ——- either by smoking or through injection. It (d) ——- a man to death slowly. It has dangerous effect on human body. An addict (e) ——- drowsy and (f) ——- appetite. It also (g) ——- brain and an internal functions of the body. This drug addiction is a (h) ——- problem in our country.

65.  Complete the following text with the right form of verbs. (Mirpur Bangla School & College, Dhaka)

        He (a) ——- (be) now (b) ——- (work) in a school as an assistant teacher. He (c) ——- (start) working on the 1st of June in 2002. His salary (d) ——- (be) handsome enough. But he (e) ——- (think) his work is more important than his salary. However, it (f) ——- (be) a very hard work (g) ——- (take) care of students, education. It is (h) ——- (say) that a mother is the best teacher.

66.  Fill in the gaps with right form of verbs. (Shaheed Police Smrity College, Mirpur, Dhaka; Jamalpur Zilla School, Jamalpur)

crossknowtremblehavedrownbecomebegin

        One day, a scholar (a) ——- a river on a boat. Suddenly a ghastly wind (b) ——- to blow. The scholar (c) ——- with fear. The boatman said to him, “Do you (d) ——- how to swim?” The answer from the scholar (e) ——- in the negative. Then the boatman said, “Very soon you are going to (f) ——-. You (g) ——- a lot of knowledge but it (h) ——- to use at this moment.”

67.  Complete the following text with suitable verbs in the box with their right form. (Uttara High School & College, Dhaka; Govt. Laboretory High School, Khulna)

dependtakegoberegainwaitrecovermake

        A proverb (a) ——- that time and tide (b) ——- for none. Since the dawn of civilization time is moving. It goes on and on. It (c) ——- any rest. Lost health (d) ——- by medicine and proper caring and nursing, lost money by dint of hard labour, but lost time cannot (e) ——- by any means. Success in life (f) ——- on the best use of time. If we (g) ——- a proper division of our time and do our duties accordingly, we (h) ——- sure that we would be able to march in life and reach the cherished goal of our life.

68.  Complete the following text with suitable verbs in the box with their right form. (Savar Cantonment Public School & College, Dhaka)

leadworkmakebuildbeprosperrememberdepend

        Bangladesh (a) ——- full of natural resources. The prosperity of the country (b) ——- on the proper utilization of the resources. So we should all try to (c) ——- up our country by (d) ——- hard. We should not (e) ——- a lazy life. No nation (f) ——- without industry. It (g) ——- that industry is the key to success. If we (h) ——- the best use of our resources, Bangladesh will become prosperous.

69.  Complete the following text with suitable verbs in the box with their right form. (Safiuddin Sarker Academy & College, Gazipur)

doprotectgrowtakebuildprovidecontaindivide

        The foods that we eat can (a) ——- into six kinds according to what substance they (b) ——- and what benefits they (c) ——- to us. Fish, meat, peas and milk (d) ——- us with protein and (e) ——- our body and help us grow. If we (f) ——- all these, we cannot (g) ——- well. Vitamins and mineral salts (h) ——- us from diseases which keep us fit for work.

70.  Complete the following text with suitable verbs in the box with their right from. (Rani Bilashmoni Govt. Boys’ High School, Gazipur)

achievekillriseoppressdefeatengagesuppressbecome

        Bangladesh is an independent country. In 1971 we (a) ——- independent. Earlier, we were (b) ——- by the Pakistani rulers. They (c) ——- us in every sector of our life. Our valiant soldiers (d) ——- against their oppression and were (e) ——- in a nine months long war. Millions of our people were (f) ——- brutally throughout the long nine months. At last, our soldiers (g) ——- them and we (h) ——- our victory on December 16, 1971.

71.   Complete the following text with suitable verbs in the box with their right form. (Faridpur Zilla School, Faridpur)

bedependexpectmotivateexploitmakeengageprevailafflictfind

        Bangladesh is (a) ——- with lots of problems. Among them child labour is an acute one. Today millions of children are (b) ——- in various odd jobs. Today’s children are the future adult people. If a large number of our future adults are oppressed and (c) ——-, we can (d) ——- anything good for the nation. We believe that Bangladesh will be free from child labour. Different humanitarian organizations are (e) ——- speaking against child labour (f) ——- in the country. Mass media also (d) ——- a focus on this issue (h) ——- people towards banning child labour.

72.  Complete the following text with suitable verbs in the box with their right form. (Rajbari Govt. High School, Rajbari)

wishobservereceivebebegininviteputphone

        My birthday (a) ——- every year. Some days ago my last birthday (b) ——- observed. I (c) ——- my friends to join my birthday party. My parents (d) ——- our relatives to attend the party. I (e) ——- on a new dress. The invited guests and friends (f) ——- to come at 5 pm. I (g) ——- them heartily. All (h) ——- me a happy birthday.

73.  Complete the following text with suitable verbs in the box with their right form. (Bindubasini Govt. Boys’ High School, Gangail)

dochangepreparedevelophelpexerciseclaimmemorise

        Most of the students of our country are expert in (a) ——- answers. They don’t prepare notes themselves. They get them (b) ——- by their tutors. Their tutors (c) ——- their brain for the students. So, the thinking power of the students does not (d) ——-. They don’t have any command of the language. They, of course (e) ——- well in the examination. But for this they can (f) ——- no credit of their own. This result does not (g) ——- them in their later life. It is high time they (h) ——- their attitudes.

74.  Complete the passage with suitable verbs in the box with their right form. (Bindubasini Govt. Girls’ High School, Tangail)

helppublishtakereadmakeplaybehave

        Newspaper (a) ——- a vital role in modern civilization. It (b) ——- important news and views of home and abroad. A student must (c) ——- the habit of reading the newspaper everyday. Mere bookish knowledge (d) ——- not sufficient in this competitive world. A newspaper (e) ——- him enrich his general knowledge and (f) ——- him aware of the newspaper is like a frog in a narrow well. Being ignorant of the current affairs, He (h) ——- part in the talks and discussion in an enlightened society and thus he feels like a fish out of water.

75.   Complete the following text with suitable verbs in the box with their right form. (Khulna Public College, Khulna)

stopfollowmakebeknowsucceedneglectwait

        Time (a) ——- very valuable. This valuable time (b) ——- for anybody. No power (c) ——- it. It (d) ——- no pause in its course. It is not wise to (e) ——- time. The man who makes the best use of time is sure to (f) ——-. All the famous persons of the world have (g) ——-  the best use of time. We should (h) ——- them.

76.  Complete the following text with suitable verbs in the box with their right form. (Khulna Govt. Girls’ High School, Khulna)

sacrificeworktakeconspireinvolveknowbehave

        Love for one’s country (a) ——- as patriotism. Every man (b) ——- great love for his country. Many of our freedom fighters (c) ——- their lives in 1971 for the sake of our country due to this noble virtue. At present still there (d) ——- some people who (e) ——- relentlessly for the sake of our country. On the country, some people still (f) ——- against the country. Besides, some people (g) ——- in corruption. They are the enemies of the country. We (h) ——- determined action against these culprits.

77.  Complete the following text with suitable verbs in the box with their right form. (Khulna Collegiate Girls’ School, Khulna)

saybereachparticipateprovideenrichtravelchange

        Human life (a) ——- not static but dynamic. A man cannot (b) ——- the highest peak of success if he (c) ——- in extra co-curricular activities. Travelling is also an important part of co-curricular activities. It is (d) ——- which (e) ——- our knowledge, experience and (f) ——- our attitudes. Therefore, travelling (g) ——- us with knowledge and practical experience. It can be clearly (h) ——- that our knowledge can be mobilized by travelling the different corners of the vast globe.

78.  Complete the following text with right form of the verbs given in box. (Kushtia Zilla School, Khshtia)

bringburysayhaveseemakebe

        During the last autumn vacation I (a) ——- such an opportunity to visit Bagerhat, a great historical place. There I (b) ——- the Mazar of Khan Jahan Ali. It is a fine one-storeyed building. It has a beautiful dome. Hazrat Khan Jahan Ali (c) ——- there. The tomb (d) ——- of cut out stones. It cannot be accurately (e) ——- where from these (f) ——-. On the tomb there (g) ——- inscriptions in Arabic. An inscription (h) ——- that he died on the 25th October, 1459.

79.  Complete the following text with suitable verbs in the box with their right form. (Shandhani School & College, Gangni, Meherpur)

wasterepentpreparewaitcallbearbewaste

        Student life (a) ——- the best time for (b) ——- oneself for future. It is (c) ——- the seed time of life. So, during this period of life students mustn’t (d) ——- time. They (e) ——- in mind that time (f) ——- for none. If a student (g) ——- his time, he will have to (h) ——- in future.

80.  Complete the following text with suitable verbs in the box with their right form. (Sathkira Govt. High School, Satkhira)

preparewantachievehavecarryresultinspireland

        Man (a) ——- an unquenchable thirst for knowledge. He is not satisfied with what he has known and seen. He (b) ——- to know and see more and more. The curiosity to know more (c) ——- him to undertake and (d) ——- out hard and dangerous tasks which eventually (e) ——- in epoch-making discoveries and inventions. In the fields of science and technology, man, in the meantime, (f) ——- what was once inconceivable. Man has already (g) ——- on the moon and (h) ——- for a journey to the Mars.

81.  Complete the following text with suitable verbs from the box with their right form. (Satkhira Govt. Girls’ High School, Satkhira)

trustmaketellachievecultivategainbelievespeak

        Truthfulness (a) ——- a man really great. A man is not (b) ——- by others if he does not (c) ——- the habit of (d) ——- the truth. A man who is not (e) ——- by anybody can’t (f) ——- any position. A man can (g) ——- ‘his ends once or twice by (h) ——- lies.

Right Form of Verb Exercise For JSC Questions Solutions

1.     Right form of verbs

        (a) was surprised (b) had gone (c) was taking (d) know (e) had been (f) became (g) seeing   (h) wished.

2.     Right form of verbs

        (a) regarded; (b) go; (c) Obtaining; (d) is getting / get; (e) redefined; (f) enlightening; (g) lead; (h) took.

3.     Right form of verbs

        (a) is; (b) waits; (c) stop; (d) neglect; (e) makes; (f) succeed; (g) has; (h) followed.

4.     Right form of verbs

        (a)   is; (b) depends; (c) build; (d) working; (e) lead; (f) can prosper; (g) should be remembered; (h) make.   

5.     Right form of verbs

        (a) going; (b) came; (c) climbed; (d) know; (e) lay; (f) were; (g) thought; (h) went.

6.     Right form of verbs

        (a)   goes; (b) wait; (c) does not take; (d) recovered; (e) regained; (f) depends; (g) (h)   will be.

7.     Right form of verbs

        (a) sleeping; (b) woke; (c) saw; (d) was doing; (e) asked; (f) was writing; (g) replied; (h) loves (gvbeRvwZ‡K fvjevmvi e¨vcviUv wPišÍb, ZvB loves n‡jv)

8.     Right form of verbs

        (a) preparing (for-Gi ci ing hy³ verb nq|); (b) called; (c) waste; (d) bear (bear / keep in mind = ¯§iY ivLv)

      (e) waits (subject time (kãwU) singular, ZvB waits n‡jv); (f) repent (AbyZß nIqv); (g) make; (h) follow.

9.     Right form of verbs

        (a) is; (b) waits; (c) is moving; (d) neglect; (e) succeedj; (f)made; (g); follow; (h) perform.

10.  Right form of verbs (Rajuk Uttara Model College, Dhaka)

        (a) give; (b) stand; (c) endure; (d) produce; (e) get; (f) is; (g) is; (h) is.

11.  Right form of verbs (P. N. Govt. Girls’ High School, Rajshahi)

        (a) is; (b) have; (c) prosper; (d) think; (e) depends; (f) toiled; (g) inventing; (h) have added.

12.  Right form of verbs (Dinajpur Zilla School, Dinajpur)

        (a) called; (b) replete; (c) is; (d) have; (e) performing; (f) will suffer/suffers; (g) crowned; (h) becomes/will become.

13.  Right form of verbs (Jessore Zilla School, Jessore)

        (a) is going; (b) got; (c) reached; (d) entering; (e) saw; (f) were; (g) gave; (h) was beating.

14.  Right form of verbs (Comilla Zilla School, Comilla)

        (a) has been suffering;  (b) was sent;  (c) Hearing;  (d) rushed;  (e) found; (f) were; (g) did not take; (h) were misbehaving.

15.  Right form of verbs (Chittagong Collegiate School, Chittagong)

        (a) reigns; (b) triumph; (c) preaching; (d) respected; (e) not continue; (f) understand; (g) troubled; (h) stopped.

16.  Right form of verbs (Jalalabad Cantt. Public School & College, Sylhet)

        (a) is; (b) is; (c) spoken; (d) taken; (e) learn; (f) enrich; (g) learnt; (h) like.

17.  Right form of verbs (Barisal Govt. Girls’ High School, Barisal)

        (a) needed; (b) is going; (c) developing; (d) keep; (e) learning; (f) is; (g) designed; (h) be revised.

18.  Right form of verbs (Viqarunnisa Noon School & College, Dhaka)

        (a) form; (b) remains; (c) attain; (d) show; (e) respect; (f) cost; (g) learn; (h) beginning.

19.  Right form of verbs (Ideal School & College, Motijheel, Dhaka)

        (a) increasing; (b) caused; (c) cut; (d) plant; (e) losing; (f) seen; (g) poses; (h) destroying.

20.  Right form of verbs (Dhaka Residential Model College, Dhaka)

        (a) achieving; (b) is; (c) does not try; (d) adopting; (e) rises; (f) speaking; (g) should determine; (h) lead.

21.  Right form of verbs (Bogra Zilla School, Bogra)

        (a) is regarded; (b) is earned; (c) has; (d) has to be; (e) being; (f) follow; (g) fails; (h) will lag.

22.  Right form of verbs (Rangpur Zilla School, Rangpur)

        (a) go; (b) appeals; (c) have spent; (d) are; (e) could; (f) were; (g) am; (h) fill.

23.  Right form of verbs (Udayan Higher Secondary School, Dhaka)

        (a) does not make/cannot make; (b) is earned; (c) cannot bring; (d) are spent; (e) running; (f) is; (g) get; (h) is satisfied.

24.  Right form of verbs (Monipur Uchcha Vidyalaya & College, Mirpur, Dhaka)

        (a) accompanied (b) reached; (c) looked; (d) saw; (e) had been run; (f) crying; (g) wounded; (h) took.

25.  Right form of verbs (Adamjee Cantonment Public School, Dhaka)

        (a) faces; (b) has already built; (c) is trying; (d) never be solved; (e) is not turned; (f) exports; (g) contribute; (h) sending.

26.  Right form of verbs   (The Millennium Stars School & College, Rangpur Cantonment, Rangpur)

        (a) form; (b) remains; (c) show; (d) have; (e) cost; (f) acquire; (g) win; (h) practice.

27.  Right form of verbs (Rangpur Govt. Girls’ High School, Rangpur)

        (a) is; (b) plays; (c) building; (d) removes; (e) speaking; (f) hold; (g) does not sit; (h) makes.

28.  Right form of verbs (Cantonment Public School & College, Saidpur, Nilphamari)

        (a) flies; (b) goes; (c) stand; (d) sank; (e) have entered; (f) are; (g) can change; (h) working.

29.  Right form of verbs (Lions School & College, Saidpur, Nilphamari)

        (a) wait; (b) waste; (c) succeed; (d) made; (e) follow; (f) neglects; (g) look; (h) made.

30.  Right form of verbs (Thakurgaon Govt. Boys’ High School, Thakurgaon)

        (a) is; (b) relies; (c) lead; (d) build; (e) work; (f) brings; (g) contribute; (h) are.

31.  Right form of verbs (Thakurgaon Govt. Girls’ High School, Thakurgoan)

        (a) is facing; (b) has taken; (c) is trying/tries; (d) not be solved; (e) is not turned; (f) providing; (g) should be given; (h) needs.

32.  Right form of verbs (Gaibandha Govt. Girls’ High School, Gaibandha; Bogra Govt. Girls’ High School, Bogra; Govt. KD High School, Naogan)

        (a) regarded; (b) go; (c) Obtaining; (d) redefined; (e) took; (f) can help; (g) can deny; (h) dependent.

33.  Right form of verbs   (Gaibandha Govt. Boys’ High School, Gaibandha)

        (a) controls; (b) taken; (c) cannot earn; (d) replaced; (e) groaning.

34.  Right form of verbs   (Govt. Girls’ High School, Jessore)

        (a) saying; (b) want; (c) established; (d) to shoulder; (e) is; (f) to shine; (g) had been; (h) undergoing.

35.  Right form of verbs (Dawood Public School, Jessore Cantt., Jessore)

        (a) were; (b) awakened; (c) was; (d) began; (e) made; (f) helped; (g) break; (h) established.

36.  Right from of verbs. (Vidyamoyee Govt. Girls; High School, Mymensingh)

        (a) exercises; (b) shaping; (c) moulding; (d) learn; (e) take; (f) goes; (g) get; (h) live.

37.  Right form of verbs. (Mymensingh Zilla School, Mymensingh; Momena Ali Biggan School, Sirajganj; Milestone College Dhaka)

        (a) are living; (b) has made; (c) cannot think; (d) has linked; (e) are; (f) have brought; (g) send; (h) have conquered.

38.  Right form of verbs. (Rajshahi Govt. Girls’ High School, Rajshahi)

        (a) is compared; (b) destroys; (c) goes; (d) is disturbed; (e) is forbidden; (f) are achieved; (g) be destroyed; (h) Being.

39.  Right form of verbs. (Rajshahi Collegiate School, Rajshahi)

        (a) brought; (b) was not invented; (c) took (d) worked; (e) came; (f) are using; (g) has  been introduced; (h) will be.

40.  Right form of verbs. (Govt. Laboratory High School, Rajshahi.)

        (a) gained; (b) has digitalized; (c) collect; (d) submitted; (e) erases; (f) saves; (g) denied (h) is.

41.  Right form of verbs. (Bogra Cantonment Public School & College, Bogra; Gazipur Cantonment Board Inter High School, Gazipur)

        (a) was going; (b) got; (c) reached; (d) entering; (e) saw; (f) were; (g) gave; (h) was beating.

42.  Right form of verbs. (BIAM Model School & College, Bogra)

        (a) goes; (b) described; (c) cannot be imagined; (d) is used; (e) is thought; (f) depends; (g) brings; (h) turn.

43.  Right form of verbs. (Pabna Govt. Girls’ High School, Pabna)

        (a) was taking; (b) situated; (c) fell; (d) saw; (e) jumped; (f) came; (g) recognized; (h) lived.

44.  Right form of verbs. (Pabna Zilla School, Pabna)

        (a) breeds; (b) make; (c) cultivates; (d) trusted; (e) can achieve; (f) telling.

45.  Right form of verbs. (Dinajpur Govt. Girls’ High School, Dinajpur)

        (a) climbed; (b) took; (c) picked; (d) gave; (e) felt; (f) got; (g) took; (h) divided.

47.  Right form of verbs. (Cantonment Board High School, Dinajpur)

        (a) goes; (b) wait; (c) does not take; (d) recovered; (e) regained; (f) depends; (g) make; (h) are.

48.  Right form of verbs. (Cantonment Public School & College, Rangpur)

        (a) considered; (b) rise; (c) becomes; (d) required; (e) achieve; (f) save; (g) Keeping; (h) educate.

49.  Right form of verbs . (Mirzapur Cadet College, Tangail)

        (a) is taken; (b) are helped; (c) do not have; (d) are.

50.  Right form of verbs. (Mymensingh Girls’ Cadet College, Mymensingh)

        (a) enlighten; (b) think; (c) Based; (d) unemployed; (e) does; (f) aims; (g) developing; (h) broadens.

51.  Right form of verbs. (Rajshahi Cadet College, Rajshahi)

        (a) is; (b) has; (c) get/become; (d) should be; (e) can; (f) enables; (g) can sleep; (h) can work.

52.  Right form of verbs. (Pabna Cadet College, Pabna; Kushtia Govt. Girls’ High School, Kustia)

        (a) means; (b) lies; (c) cannot think; (d) enables; (e) makes; (f) improves; (g) gives; (g) gets.

53.  Right form of verbs. (Joypurhat Girls’ Cadet College, Joypurhat)

        (a) need; (b) irrigate; (c) is; (d) can; (e) causes; (f) formed; (h) invented.

54.  Right form of verbs. (Rangpur Cadet College, Rangpur)

        (a) went; (b) slept; (c) woke; (d) rushed; (e) was burning; (f) were running; (g) lived; (h) were crying.

55.  Right form of verbs. (Jhenidah Cadet College, Jhenidah)

        (a) symbolizes; (b) inaugurated; (c) commemorate; (d) proved; (e) constructing; (f) was laid; (g) covers; (h) includes.

56.  Right form of verbs. (Comilla Cadet College, Comilla)

        (a) has; (b) die; (c) invented; (d) be; (e) escape; (f) try; (g) needs; (h) helps.

57.  Right form of verbs. (Faujdarhat Cadet College, Chittagong)

        (a) adopted; (b) is; (c) lasts; (d) starts; (e) was divided; (f) consist; (g) are held; (h) make.

58.  Right form of verbs. (Sylhet Cadet College, Sylhet)

        (a) go; (b) appeals; (c) have spent; (d) are; (e) could; (f) were; (g) charm; (h) refresh.

59.  Right form of verbs. (Barisal Cadet College, Barisal)

        (a) prepare; (b) formed; (c) influence; (d) should; (e) maintaining; (f) should not be; (g) should not be; (h) should.

60.  Right form of verbs. (Milestone College, Dhaka)

        (a) live/are living; (b) has made; (c) cannot think; (d) has linked; (e) are; (f) have brought; (g) send; (h) have conquered.

61.  Right form of verbs. (Shamsul Haque Khan School & College, Dhaka)

        (a) lived; (b) had; (c) loved; (d) obeyed; (e) was sleeping; (f) woke; (g) felt; (h) told.

62.  Right form of verbs. (Motijheel Govt. Boys’ High School, Dhaka)

        (a) had died; (b) was succeeded; (c) was; (d) had; (e) overcame; (f) ascending; (g) establish; (h) had lost.

63.  Right form of verbs. (Bir Shreshtha Noor Mohammad Public College, Dhaka)

        (a) needed; (b) going; (c) developing; (d) keep; (e) learning; (f) learning; (g) designed; (h) be modified.

64.  Right form of verbs. (Motijheel Model High School & College, Dhaka)

        (a) was; (b) went; (c) learnt; (d) did not quarrel; (e) keep; (f) respected; (g) listened; (h) loved.

65.  Right form of verbs. (Govt. Laboratory High School, Dhaka)

        (a) attraction; (b) means; (c) taken; (d) leads; (e) feels; (f) loses; (g) damages; (h) serious.

66.  Right form of verbs. (Mirpur Bangla School & College, Dhaka)

        (a) is; (b) working; (c) started; (d) is; (e) thinks; (f) is; (g) to take; (h) said.

67.  Right form of verbs. (Shaheed Police Smrity College, Mirpur, Dhaka; Jamalpur Zilla School, Jamalpur)

        (a) was crossing; (b) began; (c) was trembling; (d) know; (e) was; (f) be drowned; (g) have; (h) won’t come.

68.  Right form of verbs. (Uttara High School & College, Dhaka; Govt. Laboratory High School, Khulna)

        (a) goes; (b) wait; (c) does not take; (d) can be recovered; (e) be regained; (f) depends; (g) make; (h) are.

69.  Right form of verbs. (Savar Cantonment Public School & College, Dhaka)

        (a) is; (b) depends; (c) build; (d) working; (e) lead; (f) can prosper; (g) should be remembered; (h) make.

70.  Right form of verbs. (Safiuddin Sarker Academy & College, Gazipur)

        (a) be divided; (b) contain; (c) do; (d) provide; (e) build; (f) do not take; (g) grow; (h) protect.

71.  Right form of verbs. (Rani Bilashmoni Govt. Boys’ High School, Gazipur)

        (a) became; (b) oppressed; (c) suppressed; (d) rose; (e) engaged; (f) killed; (g) defeated; (h) achieved.

72.  Right form of verbs. (Faridpur Zilla School, Faridpur)

        (a) afflicted; (b) engaged; (c) exploted; (d) not expect; (e) found; (f) prevailing; (g) make; (h) to motivate.

73.  Right form of verbs. (Rajbari Govt. High School, Rajbari)

        (a) is observed; (b) was; (c) invited; (d) phoned; (e) put; (f) began; (g) received; (h) wished.

74.  Right form of verbs. (Bindubasini Govt. Boys’ High School, Gangail)

        (a) memorizing; (b) prepared; (c) exercise; (d) develop; (e) do; (f) claim; (g) help; (h) changed.

75.  Right form of verbs. (Bindubasini Govt. Girls’ High School, Tangail)

        (a) plays; (b) publishes; (c) have; (d) is; (e) helps; (f) makes; (g) does not read; (h) cannot take.

76.  Right form of verbs. (Khulna Govt. Girls’ High School, Khulna)

        (a) is known; (b) has; (c) sacrificed; (d) are; (e) work/are working; (f) conspire/are conspiring; (g) are involved; (h) should take/have to take.

77.  Right form of verbs. (Khulna Collegiate Girls’ School, Khulna)

        (a) is; (b) reach; (c) does not participate; (d) traveling; (e) enriches; (f) changes; (g) rapidly; (h) already.

78.  Right form of verbs. (Kushtia Zilla School, Kushtia)

        (a) had; (b) saw; (c) was buried; (d) was made; (e) said; (f) were brought; (g) are; (h) says.

79.  Right form of verbs. (Shandhani School & College, Gangni, Meherpur)

        (a) is; (b) preparing; (c) called; (d) waste; (e) should bear; (f) waits; (g) wastes; (h) repent.

80.  Right form of verbs. (Satkhira Govt. High School, Satkhira)

        (a) makes; (b) believed; (c) cultivate; (d) speaking; (e) trusted; (f) gain; (g) achieve; (h) telling.

81.  Right form of verbs. (Shakhira Govt. Girls’ High School, Satkhira)

        (a) makes; (b) believed; (c) cultivate; (d) speaking; (e) trusted; (f) achieve; (g) gain; (h) telling.

Mustafij Sir

Recent Posts

HSC Synonym Antonym Board Question All Board

WordsMeaningsSynonyms    antonymsouterবাইরেরoutmostinnerproletarianদরিদ্র/সর্বহারাWorking-classmorallaunchশুরু করাIntroductionwithdrawpreparingপ্রস্তুতিGet-readydoubtfaultlesslyনির্দোষভাবেabsolutelyfaultynauseaবমিবমিভাবvomitingheadachediscomfortঅসস্তিupsetcomfortmaintainedবজায় করাsustainuselessLaterকরেnextearlierdynamicগতিশীলAggressivestaticplanপরিকল্পনাproposaldisorderaimলক্ষGoalaimlessdirectionনিদ্ধেশনাInstructionnoticeprofessionপেশাJobjoblesssuitsআকারFormnothingaptitudeযোগ্যতাAttitudedislikevaryপরিবর্তীতVariousfixeducatedশিক্ষিতLearneduneducatedcitizenনাগরিকnativeforeignervirtueপূর্ণgoodnessevilA lotঅনেকhugelittlecourteousবিনয়ীpoliterudediscourtesyঅবিনয়ীrudenesscourteouswinজয় করাgainloseenemyশত্রুfoefriendensureনিশ্চিত করাconfirmcancelangerরাগtempercalmnessremoveঅপসারণcancelputcordialityসোহার্দrudenessdiscordialitydifferentভিন্নDissimilarsameseeksঅনুসন্ধানPursuefindeagerআগ্রহীinterestdisinterestedobservationপর্যবেক্ষণExaminationneglectmereএকমাত্রImmenseabnormalalertসতর্কWatchfulunawarelatentসুপ্তOpenrealizedinstructorsপ্রশিকক্ষকteacherstudentguideগাইডmentormisguidewayপথ/উপায়Pathpartfascinatingচমৎকারexcellentunattractiveinterestআগ্রহীeagerdisregardimpatientঅধৈয্যIntolerancepatientillogicalঅযোক্তিকunethicalLogicalindifferentউদাসীনUninteresteddifferentethicallyনৈথিকভাবেlawfullyUnethicalGood-lookingচমৎকারAttractiveUnattractiveDarkঅন্ধকারBlackbrightFlawlessস্থিরperfectflawedShinyউজ্জল্যbrightdarkSlenderসরুthinfatGracefulকরুনাময়elegantungracefulStylishlyআড়ম্বরপূর্ণভাবেattractivesimplyAppreciatesপ্রশংসা করেpriesCriticizeNoticeলক্ষ করেadvertisementoverlookAmbitionউচ্ছাকাঙকাAim/desirelazinessRequireপ্রয়োজনneedanswerProficiencyদক্ষতাskilledincompetenceWonderআশ্চয্যSurprisedisinterestTestedপরীক্ষীতverifiednewEquallyসমানভাবেsimilarlyUnequallyDisappointingহতাশাজনকInceptingappointingPresumablyসম্ভবতdoubtlesslyimprobableQualifyযোগ্যতাcertifyDisqualifywrongভুলmistakewriteIdealআদর্শModelbadMasterদক্ষTeacherStudentMakesতৈরীcreateBreak/destroyMethodপদ্ধতিSystemdifferenceConvincingবিশ্বাসীsatisfactoryUnconvincingPraisesপ্রশাংসা করেhurrahCriticizeMistakeভুলErrorsagacityAngryরাগevilcalmSimpleসাধারণgeneralComplexmoralনৈতিকethicalamoralAcceptedগৃহিতreceivedrejectedSincerityআন্তরিকতাGood-willinsincerityResponsibilityদায়িত্বdutiesdepartureComplexityজটিলতাcomplicationSimplicityEnvyহিংসাlastedpraiseVicesমন্দevilVirtueImpactsপ্রভাবeffectfailsAwarenessসতর্কতাalertnessunawarenessOut-comeবাহিরের দিকresultcauseimportanceগুর্ত্বপূর্ণsignificanceinsignificanceFriendবন্দুenemyfoeNeedপ্রয়োজনcommitment/necessaryavoidSympathyসহানুভুতিkindnessrudenessProveপ্রমানconfirmdisproveFalseমিথ্যাwrongtrueHarmক্ষতিকরlosshelpLaughহাসাburstcryPleasureআনন্দhappinesssadnessBringআনাcarryleaveideaধারণাconceptnothingAllowঅনুমতিpermitdenyFreedomস্বাধীনতাindependencebondageOpinionমতামতviewawarenessFairমেলাcleanunfairEqualসমানbalancedunequalDivisionবিভাগdistributionunionElectনির্বাচন করাvoterefuseSystemনিয়ম-নীতিprocesspartTreatmentচিকিৎশা করাcuringhurtFacilityসুবিধাadvantagepainNeverকখন নয়NotingAlwaysWeakerদুর্বলrottenstrongerDiscourageনিরুৎসাহিতdroopEncourageFrustratingহতাশাজনকBuffaloingsatisfyingInterestআগ্রহীeagernessdiscourageAbilityসক্ষমতাCapabilityinabilityDreamস্বপ্নfancyfactBestসবচেয়ে ভালfinestworstSuccessসফলতাachievementfailureachieveঅর্জন…

8 months ago

সরকারি চাকরী খুজুন ঘরে বসেঃ ইন্টারনেটে চাকরীর খোঁজ(জরুরী ধাপ ও নির্ভরযোগ্য সকল ওয়েবসাইট)

আপনি যদি ইন্টারনেটে চাকরির সন্ধান করছেন এবং আপনি এটি সম্পর্কে জানতে চান তবে আপনি সঠিক…

2 years ago

HSC 2023- English 1st Paper Model Question and Solution-1

Model Question 1 Part-I : Marks 60 1. Read the passage and answer the questions…

2 years ago

SSC-২০২৩ হিন্দু ধর্ম-পঞ্চম অধ্যায়- দেবদেবী ও পূজা সৃজনশীল ও বহুনির্বাচনি প্রশ্নোত্তর

পঞ্চম অধ্যায় দেবদেবী ও পূজা এ অধ্যায়ে আমরা পূজা, পুরোহিতের ধারণা ও যোগ্যতা, দেবী দুর্গা,…

2 years ago

SSC-২০২৩ হিন্দু ধর্ম-চতুর্থ অধ্যায়- হিন্দুধর্মে সংস্কার সৃজনশীল ও বহুনির্বাচনি প্রশ্নোত্তর

চতুর্থ অধ্যার হিন্দুধর্মে সংস্কার আমাদের এই পার্থিব জীবনকে সুন্দর ও কল্যাণময় করে গড়ে তোলার লড়্গ্েয…

2 years ago

SSC-২০২৩ হিন্দু ধর্ম-তৃতীয় অধ্যায়, ধর্মীয় আচার-অনুষ্ঠান সৃজনশীল ও বহুনির্বাচনি প্রশ্নোত্তর

তৃতীয় অধ্যায় ধর্মীয় আচার-অনুষ্ঠান আমাদের জীবনকে সুন্দর ও কল্যাণময় করার জন্য যেসব আচার-আচরণ চর্চিত হয়…

2 years ago

This website uses cookies.